PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.5G390500.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB
Protein Properties Length: 295aa    MW: 32438.6 Da    PI: 6.6298
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.5G390500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding31.54.1e-103985347
                        SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwqky 47
                         WT+eE +l+ +a ++   +    W+++a++++ ++t  +++++++++
  Sevir.5G390500.1.p 39 EWTAEENKLFEEALARIDRNapdKWERVAAMLP-RKTVVDVVNHYHDL 85
                        7*****************99*************.***********976 PP

2Myb_DNA-binding46.86.7e-15144188347
                         SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         +WT+eE++l++ + k++G g+W+ I+r+  ++Rt+ q+ s+ qky
  Sevir.5G390500.1.p 144 PWTEEEHKLFLMGLKKYGRGDWRNISRKYVTTRTPTQVASHAQKY 188
                         7*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.01E-103485IPR009057Homeodomain-like
PROSITE profilePS512938.0373588IPR017884SANT domain
SMARTSM007172.4E-73688IPR001005SANT/Myb domain
PfamPF002497.9E-83985IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.7E-53984IPR009057Homeodomain-like
CDDcd001671.94E-73985No hitNo description
PROSITE profilePS5129417.299136193IPR017930Myb domain
SuperFamilySSF466891.36E-17139193IPR009057Homeodomain-like
TIGRFAMsTIGR015578.4E-17140191IPR006447Myb domain, plants
SMARTSM007175.5E-12141191IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.9E-11142187IPR009057Homeodomain-like
PfamPF002492.6E-12144188IPR001005SANT/Myb domain
CDDcd001671.23E-11144189No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 295 aa     Download sequence    Send to blast
MMAEAWTQVL LPSTAPCFSG QPSCFWQDRL ADFGGIGDEW TAEENKLFEE ALARIDRNAP  60
DKWERVAAML PRKTVVDVVN HYHDLEYDVG FIEAGLVPFP HYSSSPPSSG FTLEDWDGGD  120
GGFRRGYCLK RARGPDQERK KGIPWTEEEH KLFLMGLKKY GRGDWRNISR KYVTTRTPTQ  180
VASHAQKYFI RLNSGGKDKR RSSIHDITTI NLPDEDRGNA SPSPPSAATA ATNPSVADQF  240
AALVDAKPFM APLPGALGVA HPYGNVKLEP KSALVAGLGF DDSILVQMQC AAQL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A1e-1430105176RADIALIS
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0349000.0BT034900.1 Zea mays full-length cDNA clone ZM_BFb0026O20 mRNA, complete cds.
GenBankKJ7275290.0KJ727529.1 Zea mays clone pUT5389 MYB transcription factor (MYB34) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004970612.10.0PREDICTED: transcription factor DIVARICATA
SwissprotQ8S9H76e-77DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLK3XKK00.0K3XKK0_SETIT; Uncharacterized protein
STRINGSi002423m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22743796
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G58900.13e-75Homeodomain-like transcriptional regulator